PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G397900.1.p
Common NameSb01g037670, SORBIDRAFT_01g037670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 357aa    MW: 38104.7 Da    PI: 5.6095
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G397900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.6e-181461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rgrWT+eEd++l+++++++G g+W++ ++  g+ R++k+c++rw +yl
  Sobic.001G397900.1.p 14 RGRWTAEEDQILANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                          8*******************************99************97 PP

2Myb_DNA-binding56.65.8e-1867112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg+ ++eE++++v++++ lG++ W++Ia++++ gRt++++k++w+++l
  Sobic.001G397900.1.p  67 RGNISKEEEDIIVKLHATLGNR-WSLIASHLP-GRTDNEIKNHWNSHL 112
                           7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-22564IPR009057Homeodomain-like
PROSITE profilePS5129417.054961IPR017930Myb domain
SuperFamilySSF466895.24E-2911108IPR009057Homeodomain-like
SMARTSM007174.3E-131363IPR001005SANT/Myb domain
PfamPF002492.4E-161461IPR001005SANT/Myb domain
CDDcd001672.08E-111661No hitNo description
PROSITE profilePS5129426.5562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-2565116IPR009057Homeodomain-like
SMARTSM007171.6E-1766114IPR001005SANT/Myb domain
PfamPF002496.5E-1667112IPR001005SANT/Myb domain
CDDcd001673.43E-1371112No hitNo description
PfamPF066409.4E-16130190IPR010588Myb-related protein P, C-terminal
PfamPF066401.9E-52195355IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGRAPCCDKV GLKRGRWTAE EDQILANYIA EHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADVKRGNI SKEEEDIIVK LHATLGNRWS LIASHLPGRT DNEIKNHWNS HLSRQIHTYR  120
RKYTAGPDTT ITIDMSKLQS ADKRRGGRTP GRSPRSSASS SKSKKSNKQP DPEPEPESGD  180
AKGASSPATV TIDDDDKRHG GRTPGLSTKS AGSSSKTNSK QTDPEPEPEP ESGDAKGASS  240
PATAATSAAH SAVVDQDPNQ PNSSSGSTAD GPCSEDATGP WVLDPIDLGD LCQAESEIDA  300
LVSIGAGHDS VAEAFHGVGG EAQVDDLFDM DWDGFAAHLW GEPAPEQIDQ SAQLQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25121185110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283950.0KJ728395.1 Zea mays clone pUT6679 MYB transcription factor (MYB3) mRNA, partial cds.
GenBankZMU570020.0U57002.1 Zea mays P protein (P) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465387.10.0hypothetical protein SORBIDRAFT_01g037670
SwissprotP278981e-108MYBP_MAIZE; Myb-related protein P
TrEMBLC5WMJ00.0C5WMJ0_SORBI; Putative uncharacterized protein Sb01g037670
STRINGSb01g037670.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.18e-74myb domain protein 12